General Information

  • ID:  hor007047
  • Uniprot ID:  P48744
  • Protein name:  Norrin
  • Gene name:  IFNT10
  • Organism:  Mus musculus
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in the outer nuclear; inner nuclear and ganglion cell layers of the retina.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  NA
  • GO BP:  GO:0005125 cytokine activity; GO:0005109 frizzled binding; GO:0042803 protein homodimerization activity
  • GO CC:  GO:0060070 canonical Wnt signaling pathway; GO:0001974 blood vessel remodeling; GO:0001525 angiogenesis; GO:0045446 endothelial cell differentiation; GO:0008283 cell population proliferation; GO:0060856 establishment of blood-brain barrier; GO:0001508 action potential; GO:0071456 cellular response to hypoxia; GO:0070086 ubiquitin-dependent endocytosis; GO:0046697 decidualization; GO:0007224 smoothened signaling pathway; GO:0006366 transcription by RNA polymerase II; GO:0007179 transforming growth factor beta receptor signaling pathway; GO:0006099 tricarboxylic acid cycle; GO:0110135 Norrin signaling pathway; GO:1990963 establishment of blood-retinal barrier; GO:0051402 neuron apoptotic process; GO:1904390 cone retinal bipolar cell differentiation; GO:0030182 neuron differentiation; GO:0006544 glycine metabolic process; GO:0035426 extracellular matrix-cell signaling; GO:0048678 response to axon injury; GO:0097601 retina blood vessel maintenance; GO:0060041 retina development in camera-t

Sequence Information

  • Sequence:  TDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS
  • Length:  106
  • Propeptide:  MRNHVLAASISMLSLLAIMGDTDSKTDSSFLMDSQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS
  • Signal peptide:  MRNHVLAASISMLSLLAIMGDTDS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA